IPKA_MOUSE P63248
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63248
Recommended name：cAMP-dependent protein kinase inhibitor alpha
EC number：
Alternative names：(PKI-alpha) (cAMP-dependent protein kinase inhibitor, muscle/brain isoform)
Cleaved into：
GeneID：18767
Gene names (primary )：Pkia
Gene names (synonym )：
Gene names (ORF )：
Length：76
Mass：7960
Sequence：MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDDGQRSSTEQSGEAQGEAAKSES
Tissue specificity：Present at high levels in skeletal muscle and brain but is present at lower levels in heart, testis and liver.
Induction：
Developmental stage：
Protein families：PKI family