TM35A_MOUSE   Q9D328


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D328

Recommended name:Transmembrane protein 35A

EC number:

Alternative names:(Peroxisomal membrane protein 52) (PMP52)

Cleaved into:

GeneID:67564

Gene names  (primary ):Tmem35a

Gene names  (synonym ):Tmem35

Gene names  (ORF ):

Length:167

Mass:18505

Sequence:MASPRTITIMALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS

Tissue specificity:

Induction:

Developmental stage:

Protein families:DoxX family


   💬 WhatsApp