PEBP1_MOUSE   P70296


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70296

Recommended name:Phosphatidylethanolamine-binding protein 1

EC number:

Alternative names:(PEBP-1) (HCNPpp)

Cleaved into:Hippocampal cholinergic neurostimulating peptide (HCNP)

GeneID:23980

Gene names  (primary ):Pebp1

Gene names  (synonym ):Pbp Pebp

Gene names  (ORF ):

Length:187

Mass:20830

Sequence:MAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSGK

Tissue specificity:HCNP is expressed in brain. Increased expression in aged senescence-accelerated mice.

Induction:

Developmental stage:

Protein families:Phosphatidylethanolamine-binding protein family


   💬 WhatsApp