TOM6_MOUSE   Q9CQN3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQN3

Recommended name:Mitochondrial import receptor subunit TOM6 homolog

EC number:

Alternative names:(Overexpressed breast tumor protein homolog) (Translocase of outer membrane 6 kDa subunit homolog)

Cleaved into:

GeneID:66119

Gene names  (primary ):Tomm6

Gene names  (synonym ):Obtp Tom6

Gene names  (ORF ):

Length:74

Mass:7865

Sequence:MASSGVTVSAAGSASEASEVPDNVGDWLRGVFRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tom6 family


   💬 WhatsApp