OLF10_MOUSE Q60883
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60883
Recommended name：Olfactory receptor 10
EC number：
Alternative names：(Odorant receptor L45)
Cleaved into：
GeneID：18307
Gene names (primary )：Olfr10
Gene names (synonym )：
Gene names (ORF )：
Length：311
Mass：34270
Sequence：MGTFNISLGGGFILVGFSDWPALELIFFIHILIFYSITLFGNTAIIALSRTDLRLHTPMYFFLSHLSFLDLCFTTSTVPQLLINLHGQDRTISYGGCVAQVFIFLALGSTESVLLVVMAFDRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEMPVFLKLVCEDTGGTEAKMFVARAVIVAVPTMLILGSYAQIARAVLKVKSVTARRKAAGTCGSHLLVVSLFYGSAIYTYLQPKDSYSESKGKFVALFYTIITPMLNPLIYTLRNKDMKGALWKVLGRATVTG
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family