NDF6_MOUSE P48986
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48986
Recommended name：Neurogenic differentiation factor 6
EC number：
Alternative names：(NeuroD6) (Helix-loop-helix protein mATH-2) (mATH2) (Protein NEX-1) (Protein atonal homolog 2)
Cleaved into：
GeneID：11922
Gene names (primary )：Neurod6
Gene names (synonym )：Ath2 Atoh2 Nex1
Gene names (ORF )：
Length：337
Mass：38644
Sequence：MLTLPFDESVVMPESQMCRKFARQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEEEEEDREEEDENGLSRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELATPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
Tissue specificity：Specific to the nervous system of both embryos and adults. Highest levels in the cortical plate of the cerebrum.
Induction：
Developmental stage：
Protein families：