GPR18_MOUSE Q8K1Z6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K1Z6
Recommended name：N-arachidonyl glycine receptor
EC number：
Alternative names：(NAGly receptor) (G-protein coupled receptor 18)
Cleaved into：
GeneID：110168
Gene names (primary )：Gpr18
Gene names (synonym )：
Gene names (ORF )：
Length：331
Mass：37691
Sequence：MATLSNHNQLDLSNGSHPEEYKIAALVFYSCIFLIGLFVNVTALWVFSCTTKKRTTVTIYMMNVALLDLVFILSLPFRMFYYAKGEWPFGEYFCHILGALVVFYPSLALWLLAFISADRYMAIVQPKYAKELKNTGKAVLACGGVWVMTLTTTVPLLLLYEDPDKASSPATCLKISDITHLKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIMTLLLQVLVCFVPFHICFAVLMLQGQENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISVMLYRNYLRSVRRKSVRSGSLRSLSNMNSEML
Tissue specificity：Expressed in the eye including cornea, retina, iris and ciliary epithelium (at protein level) (PubMed:23461720). Expressed in spleen, liver and lymphocytes with highest expression levels in intestinal intraepithelial lymphocytes (PubMed:25348153, PubMed:26197390). {ECO:0000269|PubMed:23461720, ECO:0000269|PubMed:25348153, ECO:0000269|PubMed:26197390}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family