MCPT9_MOUSE   O35164


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35164

Recommended name:Mast cell protease 9

EC number:EC 3.4.21.-

Alternative names:(mMCP-9) (EC 3.4.21.-)

Cleaved into:

GeneID:17232

Gene names  (primary ):Mcpt9

Gene names  (synonym ):

Gene names  (ORF ):

Length:246

Mass:26652

Sequence:MQALLFLMALLLPSRAGAEEIIGGVESEPHSRPYMAYVNTFSKKGYVAICGGFLIAPQFVMTAAHCSGRRMTVTLGAHNVRKRECTQQKIKVEKYILPPNYNVSSKFNDIVLLKLKKQANLTSAVDVVPLPGPSDFAKPGTMCWAAGWGRTGVKKSISHTLREVELKIVGEKACKIFRHYKDSLQICVGSSTKVASVYMGDSGGPLLCAGVAHGIVSSGRGNAKPPAIFTRISPHVPWINRVIKGE

Tissue specificity:Selectively expressed in uterine mast cells.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Granzyme subfamily


   💬 WhatsApp