DUS14_MOUSE   Q9JLY7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JLY7

Recommended name:Dual specificity protein phosphatase 14

EC number:EC 3.1.3.16

Alternative names:(Mitogen-activated protein kinase phosphatase 6) (MAP kinase phosphatase 6) (MKP-6)

Cleaved into:

GeneID:56405

Gene names  (primary ):Dusp14

Gene names  (synonym ):Mkp6

Gene names  (ORF ):

Length:198

Mass:22311

Sequence:MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily


   💬 WhatsApp