MISSL_MOUSE   Q8BH93


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BH93

Recommended name:MAPK-interacting and spindle-stabilizing protein-like

EC number:

Alternative names:(Mitogen-activated protein kinase 1-interacting protein 1-like)

Cleaved into:

GeneID:218975

Gene names  (primary ):Mapk1ip1l

Gene names  (synonym ):

Gene names  (ORF ):

Length:242

Mass:23885

Sequence:MSDEFSLADALPEQSSAKPPAVTNTKAGHSSQGWPGSSPWSNPSAPPAMPSGLPPSSAAPSTVPFGPVPTGMYPSMPPTGPPPGPPGPFPPPGPSCPPPGVPYPAPAVPGPGPTGPYATPNMPMPELPRPYGAPTDPAAAGSLGPWGPMSSGPWAPGIAGQHPNMPYRSPGPYPTVPPPVSGAPPVPWGTVPPGAWGPAAPYPGPAGSYPTPAPHPALNNPYQVPSGPAGAPPMPGGPHSYH

Tissue specificity:

Induction:

Developmental stage:

Protein families:MISS family


   💬 WhatsApp