LPAR2_MOUSE Q9JL06
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JL06
Recommended name:Lysophosphatidic acid receptor 2
EC number:
Alternative names:(LPA receptor 2) (LPA-2) (Lysophosphatidic acid receptor Edg-4)
Cleaved into:
GeneID:53978
Gene names (primary ):Lpar2
Gene names (synonym ):Edg4 Lpa2
Gene names (ORF ):
Length:348
Mass:38777
Sequence:MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGMAYLFLMFHTGPPHCQALHQRLVPATGPAGHQPHGVSGHTAGIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVPLFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTVVIILGAFVVCWTPGQVVLLLDGLDCKTCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMRRTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL
Tissue specificity:Most abundantly expressed in testes, kidney, and embryonic brain. Other organs also express the transcript, including heart, lung, spleen, thymus, stomach, and adult brain. Several have little or no expression, including liver, small intestine, and skeletal muscle.
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family