STMN1_MOUSE   P54227


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P54227

Recommended name:Stathmin

EC number:

Alternative names:(Leukemia-associated gene protein) (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)

Cleaved into:

GeneID:16765

Gene names  (primary ):Stmn1

Gene names  (synonym ):Lag Lap18 Pr22

Gene names  (ORF ):

Length:149

Mass:17274

Sequence:MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD

Tissue specificity:Highly expressed in the lateral nucleus of the amygdala. {ECO:0000269|PubMed:16286011}.

Induction:

Developmental stage:

Protein families:Stathmin family


   💬 WhatsApp