LIT2_MOUSE Q08731
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q08731
Recommended name：Lithostathine-2
EC number：
Alternative names：(Islet of Langerhans regenerating protein 2) (REG-2) (Pancreatic stone protein 2) (PSP) (Pancreatic thread protein 2) (PTP)
Cleaved into：
GeneID：19693
Gene names (primary )：Reg2
Gene names (synonym )：
Gene names (ORF )：
Length：173
Mass：19407
Sequence：MAQNNVYLILFLCLMFLSYSQGQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA
Tissue specificity：Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, weakly in liver, but not at all in gall bladder.
Induction：
Developmental stage：
Protein families：