LIT1_MOUSE   P43137


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P43137

Recommended name:Lithostathine-1

EC number:

Alternative names:(Islet of Langerhans regenerating protein 1) (REG 1) (Pancreatic stone protein 1) (PSP) (Pancreatic thread protein 1) (PTP) (Regenerating protein 1)

Cleaved into:

GeneID:19692

Gene names  (primary ):Reg1

Gene names  (synonym ):

Gene names  (ORF ):

Length:165

Mass:18519

Sequence:MARNAYFILLSCLIVLSPSQGQEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Tissue specificity:Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp