IL1RA_MOUSE   P25085


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P25085

Recommended name:Interleukin-1 receptor antagonist protein

EC number:

Alternative names:(IL-1RN) (IL-1ra) (IRAP) (IL1 inhibitor)

Cleaved into:

GeneID:16181

Gene names  (primary ):Il1rn

Gene names  (synonym ):Il-1ra

Gene names  (ORF ):

Length:178

Mass:20274

Sequence:MEICWGPYSHLISLLLILLFHSEAACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:IL-1 family


   💬 WhatsApp