I11RB_MOUSE P70225
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70225
Recommended name：Interleukin-11 receptor subunit alpha-2
EC number：
Alternative names：(IL-11 receptor subunit alpha-2) (IL-11R subunit alpha-2) (IL-11R-alpha-2) (IL-11RA2) (Interleukin-11 receptor subunit beta) (IL-11 receptor subunit beta) (IL-11R subunit beta) (IL-11R-beta) (IL-11RB)
Cleaved into：
GeneID：100042555
Gene names (primary )：Il11ra2
Gene names (synonym )：
Gene names (ORF )：
Length：432
Mass：46731
Sequence：MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDTVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGLLQDEIPDWSQGHGQQLEAVVAQEDSLAPARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKEGPQKPGLLAPMIPVEKLPGIPNLQRTPENFS
Tissue specificity：Expression restricted to testis, lymph node and thymus. Highest level in testis. {ECO:0000269|PubMed:9073505}.
Induction：
Developmental stage：
Protein families：Type I cytokine receptor family, Type 3 subfamily