TNR14_MOUSE Q80WM9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80WM9
Recommended name：Tumor necrosis factor receptor superfamily member 14
EC number：
Alternative names：(Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
Cleaved into：
GeneID：230979
Gene names (primary )：Tnfrsf14
Gene names (synonym )：hvem
Gene names (ORF )：
Length：275
Mass：30171
Sequence：MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGAGIAGFLICTRRHLHTSSVAKELEPFQEQQENTIRFPVTEVGFAETEEETASN
Tissue specificity：Expressed at mucosal sites including colon and pulmonary epithelial cells (PubMed:22801499). Expressed in naive T cells (PubMed:19915044). {ECO:0000269|PubMed:19915044, ECO:0000269|PubMed:22801499}.
Induction：
Developmental stage：
Protein families：Tumor necrosis factor receptor superfamily