HBEGF_MOUSE Q06186
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06186
Recommended name：Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor
EC number：
Alternative names：(HB-EGF) (HBEGF)]
Cleaved into：
GeneID：15200
Gene names (primary )：Hbegf
Gene names (synonym )：Dtr Hegfl
Gene names (ORF )：
Length：208
Mass：22808
Sequence：MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGSTNQLLPTGGDRAQGVQDLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGVASSH
Tissue specificity：Most abundant in kidney, skeletal muscle, lung, spleen, brain and heart.
Induction：
Developmental stage：
Protein families：