KMT5A_MOUSE   Q2YDW7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q2YDW7

Recommended name:N-lysine methyltransferase KMT5A

EC number:EC 2.1.1.-

Alternative names:(H4-K20-HMTase KMT5A) (Histone-lysine N-methyltransferase KMT5A) (Lysine-specific methylase 5A) (PR/SET domain-containing protein 07) (PR-Set7) (PR/SET07) (SET domain-containing protein 8)

Cleaved into:

GeneID:67956

Gene names  (primary ):Kmt5a

Gene names  (synonym ):Setd8

Gene names  (ORF ):

Length:349

Mass:38845

Sequence:MARGRKMCKPRAVEAAAAAVAATAPGPEMVEQRGPGRPRSDGENVFAGQSKIYAYMSPNKCSAMRSPLQEENSVAHHEVKCPGKPLAGIYRKREEKRNTGNVIRSAVKSDEQKSKDTRRGPLAPFPNQKSEAAEPPKTPPPSCDSTNVAVAKQALKKSLKGKQAPRKKSQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKKNELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYVQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, PR/SET subfamily


   💬 WhatsApp