H2B3B_MOUSE   Q8CGP0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CGP0

Recommended name:Histone H2B type 3-B

EC number:

Alternative names:(H2B.U histone 1)

Cleaved into:

GeneID:

Gene names  (primary ):H2bu1

Gene names  (synonym ):H2bu1-ps Hist3h2bb Hist3h2bb-ps

Gene names  (ORF ):

Length:126

Mass:13908

Sequence:MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2B family


   💬 WhatsApp