K1KB8_MOUSE P07628
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07628
Recommended name：Kallikrein 1-related peptidase b8
EC number：EC 3.4.21.35
Alternative names：(Glandular kallikrein K8) (mGK-8) (Tissue kallikrein-8)
Cleaved into：
GeneID：16624
Gene names (primary )：Klk1b8
Gene names (synonym )：Klk-8 Klk8
Gene names (ORF )：
Length：261
Mass：28531
Sequence：MRFLILFLALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEIPPGADFSNDLMLLRLSKPADITDAVKPITLPTKESKLGSTCLASGWGSITPTKWQKPDDLQCVFLKLLPIKNCIENHNVKVTDVMLCAGEMSGGKNICKGDSGGPLICDSVLQGITSTGPIPCGKPGVPAMYTNLIKFNSWIKDTMTKNS
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily