YBOX2_MOUSE Q9Z2C8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2C8
Recommended name:Y-box-binding protein 2
EC number:
Alternative names:(FRGY2 homolog) (Germ cell-specific Y-box-binding protein)
Cleaved into:
GeneID:
Gene names (primary ):Ybx2
Gene names (synonym ):Msy2
Gene names (ORF ):
Length:360
Mass:38271
Sequence:MSEAEASVVATAAPAATVPATAAGVVAVVVPVPAGEPQKAGGGAGGGGGAASGPAAGTPLHAPGPRTPGNQATAASGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGARAANVTGPGGVPVKGSRYAPNRRRFRRFIPRPRPAAPPPMVAEAPSGGTEPGSEGERAEDSGQRPRRRRPPPFFYRRRFVRGPRPPNQQQPIEGSDGVEPKETAPLEGDQQQGDERVPPPRFRPRYRRPFRPRPPQQPTTEGGDGETKPSQGPTDGSRPEPQRPRNRPYFQRRRQQPPGPRQPIAAETSAPINSGDPPTTILE
Tissue specificity:Expressed in meiotic and postmeiotic male germ cells and oocytes; poorly expressed in two cell stage embryos (at protein level). Not detected in preimplantation embryos. {ECO:0000269|PubMed:11566752, ECO:0000269|PubMed:9780336}.
Induction:
Developmental stage:
Protein families: