RBX1_MOUSE   P62878


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62878

Recommended name:E3 ubiquitin-protein ligase RBX1

EC number:EC 2.3.2.27

Alternative names:(E3 ubiquitin-protein transferase RBX1) (RING finger protein 75) (RING-box protein 1) (Rbx1)

Cleaved into:E3 ubiquitin-protein ligase RBX1, N-terminally processed

GeneID:56438

Gene names  (primary ):Rbx1

Gene names  (synonym ):

Gene names  (ORF ):

Length:108

Mass:12274

Sequence:MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:10643962}.

Induction:

Developmental stage:

Protein families:RING-box family


   💬 WhatsApp