CDO1_MOUSE   P60334


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60334

Recommended name:Cysteine dioxygenase type 1

EC number:EC 1.13.11.20

Alternative names:(Cysteine dioxygenase type I) (CDO) (CDO-I)

Cleaved into:

GeneID:12583

Gene names  (primary ):Cdo1

Gene names  (synonym ):

Gene names  (ORF ):

Length:200

Mass:23026

Sequence:MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN

Tissue specificity:Highest expression in liver. Also expressed in kidney, lung, brain and small intestine. {ECO:0000269|PubMed:11602353}.

Induction:

Developmental stage:

Protein families:Cysteine dioxygenase family


   💬 WhatsApp