CST12_MOUSE Q9DAN8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DAN8
Recommended name:Cystatin-12
EC number:
Alternative names:(Cystatin TE-1)
Cleaved into:
GeneID:69362
Gene names (primary ):Cst12
Gene names (synonym ):
Gene names (ORF ):
Length:128
Mass:15036
Sequence:MLWKSVLSVALIVLGIHDCSFKFLEIDKNEEEFAISVEHVVFHFNENQDDDFAYKFLRVRRSLRQKYTLKYLVDLEMGRTLCGKYDEDIDNCPLQEGPGERKVRCTYIVETEAWVTKFTILNSTCVQT
Tissue specificity:Located at the very proximal caput epididymis (at protein level). Expressed in epididymis, Sertoli cells and testis. Also found to be weakly expressed in ovary and prostate. {ECO:0000269|PubMed:12444065}.
Induction:
Developmental stage:
Protein families:Cystatin family