CP4X1_MOUSE Q6A152
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6A152
Recommended name：Cytochrome P450 4X1
EC number：EC 1.14.14.-
Alternative names：(CYPIVX1)
Cleaved into：
GeneID：81906
Gene names (primary )：Cyp4x1
Gene names (synonym )：
Gene names (ORF )：
Length：507
Mass：58557
Sequence：MEASWLETRWARPLHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQLLTPCIGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYTEKIIQDRKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAPDLTRPPAFSSHTVLRPKHGIYLHLKKLLEC
Tissue specificity：Expressed in brain and aorta. In the brain, expressed in the Purkinje cells of the cerebellum, pyramidal neurons in the dentate gyrus of the hippocampus, cortical forebrain neurons and those of brain stem nuclei (at protein level). In addition to neurons, also expressed in cerebral vascular endothelial cells (at protein level). Also expressed in epithelial cells of the choroid plexus (at protein level). Hardly detectable in heart, lung, kidney and spleen. {ECO:0000269|PubMed:16478468}.
Induction：
Developmental stage：
Protein families：Cytochrome P450 family