CLC2H_MOUSE   Q8C1T8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C1T8

Recommended name:C-type lectin domain family 2 member H

EC number:

Alternative names:(C-type lectin-related protein F) (Clr-f)

Cleaved into:

GeneID:94071

Gene names  (primary ):Clec2h

Gene names  (synonym ):Clrf

Gene names  (ORF ):

Length:218

Mass:24162

Sequence:MNAAKVETSSMGMLQRADLTAADCLQEGEMGKKIQGKCFRIISTVSPVKLYCCYGVIMVLTVAVIALSVALSVRNKIPAMEDREPCYTACPSGWIGFGSKCFYFSEDMGNWTFSQSSCVASNSHLALFHSLEELNFLKRYKGTSDHWIGLHRASTQHPWIWTDNTEYSNLVLTRGGGECGFLSDNGISSGRSYTHRKWICSKFVSSCKSRVGSVPRHV

Tissue specificity:Detected in ileum, liver, kidney and in IL2-activated natural killer cells. {ECO:0000269|PubMed:11398965}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp