DAR12_MOUSE P50716
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50716
Recommended name：Alpha-defensin-related sequence 12
EC number：
Alternative names：(CRS4C5) (Cryptdin-related protein 4C-5) (Defensin-related cryptdin-related sequence 12)
Cleaved into：
GeneID：13221
Gene names (primary )：Defa-rs12
Gene names (synonym )：Defcr-rs12
Gene names (ORF )：
Length：91
Mass：10146
Sequence：MKKLVLLSAFVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSISFGDPEGYALQDAAIRRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
Tissue specificity：Paneth cells of the small bowel.
Induction：
Developmental stage：
Protein families：Alpha-defensin family