CPTP_MOUSE   Q8BS40


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BS40

Recommended name:Ceramide-1-phosphate transfer protein

EC number:

Alternative names:(CPTP) (Glycolipid transfer protein domain-containing protein 1)

Cleaved into:

GeneID:79554

Gene names  (primary ):Cptp

Gene names  (synonym ):Gltpd1

Gene names  (ORF ):

Length:216

Mass:24597

Sequence:MDDSEKDFNLKVVLVSFKQCLTDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSEAYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHVYDISQKLYAEHSLLDLP

Tissue specificity:

Induction:

Developmental stage:

Protein families:GLTP family


   💬 WhatsApp