QCR6_MOUSE P99028
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P99028
Recommended name：Cytochrome b-c1 complex subunit 6, mitochondrial
EC number：
Alternative names：(Complex III subunit 6) (Complex III subunit VIII) (Cytochrome c1 non-heme 11 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c reductase complex 11 kDa protein)
Cleaved into：
GeneID：66576
Gene names (primary )：Uqcrh
Gene names (synonym )：
Gene names (ORF )：
Length：89
Mass：10435
Sequence：MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK
Tissue specificity：
Induction：
Developmental stage：
Protein families：UQCRH/QCR6 family