WASC3_MOUSE   Q9CR27


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CR27

Recommended name:WASH complex subunit 3

EC number:

Alternative names:(Coiled-coil domain-containing protein 53)

Cleaved into:

GeneID:67282

Gene names  (primary ):Washc3

Gene names  (synonym ):Ccdc53

Gene names  (ORF ):

Length:194

Mass:21093

Sequence:MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSAVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLEDVTVEVSPLNVTAVTNGSHSETTSEQTQQNSTQDSGAQESEAPSENVLTVAKDPRYARYLKMVQVGVPVMAIRDKMISEGLDPELLEKPDAPVPNGESERAVEESSDSDSSFSD

Tissue specificity:

Induction:

Developmental stage:

Protein families:CCDC53 family


   💬 WhatsApp