CLD4_MOUSE   O35054


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35054

Recommended name:Claudin-4

EC number:

Alternative names:(Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor)

Cleaved into:

GeneID:12740

Gene names  (primary ):Cldn4

Gene names  (synonym ):Cper Cpetr1

Gene names  (ORF ):

Length:210

Mass:22339

Sequence:MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGLLCCSCPPRSNDKPYSAKYSAARSVPASNYV

Tissue specificity:Expressed primarily in lung and kidney (PubMed:9892664). Present in both cortical and medullar collecting ducts (at protein level) (PubMed:20921420). {ECO:0000269|PubMed:20921420, ECO:0000269|PubMed:9892664}.

Induction:

Developmental stage:

Protein families:Claudin family


   💬 WhatsApp