CCL25_MOUSE O35903
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35903
Recommended name：C-C motif chemokine 25
EC number：
Alternative names：(Chemokine TECK) (Small-inducible cytokine A25) (Thymus-expressed chemokine)
Cleaved into：
GeneID：20300
Gene names (primary )：Ccl25
Gene names (synonym )：Scya25 Teck
Gene names (ORF )：
Length：144
Mass：16733
Sequence：MKLWLFACLVACFVGAWMPVVHAQGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Tissue specificity：Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Induction：
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family