MO2R2_MOUSE   Q6XJV6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6XJV6

Recommended name:Cell surface glycoprotein CD200 receptor 2

EC number:

Alternative names:(CD200 cell surface glycoprotein receptor-like 2) (CD200 receptor-like 2) (CD200 cell surface glycoprotein receptor-like c) (CD200RLc) (Cell surface glycoprotein OX2 receptor 2)

Cleaved into:

GeneID:271375

Gene names  (primary ):Cd200r1l

Gene names  (synonym ):Cd200r2

Gene names  (ORF ):

Length:249

Mass:27408

Sequence:MHALGRTPALTLLIFIYNFVSVYTIVSVQMGTKARLCCRSIPLTKAVLITWIIKPRGQPSCIMAYKVETKETNETCLGRNITWASTPDHIPDLQISAVALQHEGNYLCEITTPEGNFHKVYDLQVLVPPEVTYFLGENRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSAVSCIVSHSTGNQSLSIELSRGTTSTTPSLLTILYVKMVLLGIILLKVGFAFFQKRNVTRT

Tissue specificity:Expressed in bone marrow, spleen, brain, lung, testis and thymus. {ECO:0000269|PubMed:15187158, ECO:0000269|PubMed:15274657}.

Induction:

Developmental stage:

Protein families:CD200R family


   💬 WhatsApp