UCP5_MOUSE Q9Z2B2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2B2
Recommended name：Brain mitochondrial carrier protein 1
EC number：
Alternative names：(BMCP-1) (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14)
Cleaved into：
GeneID：20523
Gene names (primary )：Slc25a14
Gene names (synonym )：Bmcp1 Ucp5
Gene names (ORF )：
Length：325
Mass：36286
Sequence：MGIFPGIILIFLRVKFATAAVIVSGHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI
Tissue specificity：Mainly expressed in brain, particularly abundant in cortex, hippocampus thalamus, amygdala and hypothalamus. Expressed in other tissues to a lesser extent. {ECO:0000269|PubMed:10928996}.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family