UBE2N_MOUSE   P61089


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61089

Recommended name:Ubiquitin-conjugating enzyme E2 N

EC number:EC 2.3.2.23

Alternative names:(Bendless-like ubiquitin-conjugating enzyme) (E2 ubiquitin-conjugating enzyme N) (Ubc13) (Ubiquitin carrier protein N) (Ubiquitin-protein ligase N)

Cleaved into:

GeneID:93765

Gene names  (primary ):Ube2n

Gene names  (synonym ):Blu

Gene names  (ORF ):

Length:152

Mass:17138

Sequence:MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family


   💬 WhatsApp