TNR17_MOUSE   O88472


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88472

Recommended name:Tumor necrosis factor receptor superfamily member 17

EC number:

Alternative names:(B-cell maturation protein) (CD antigen CD269)

Cleaved into:

GeneID:21935

Gene names  (primary ):Tnfrsf17

Gene names  (synonym ):Bcm Bcma

Gene names  (ORF ):

Length:185

Mass:20442

Sequence:MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLVLSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEKPTHTR

Tissue specificity:Detected in spleen, thymus, bone marrow and heart, and at lower levels in kidney and lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp