TNF13_MOUSE   Q9D777


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D777

Recommended name:Tumor necrosis factor ligand superfamily member 13

EC number:

Alternative names:(A proliferation-inducing ligand) (APRIL) (CD antigen CD256)

Cleaved into:

GeneID:69583

Gene names  (primary ):Tnfsf13

Gene names  (synonym ):April

Gene names  (ORF ):

Length:241

Mass:26889

Sequence:MPASSPGHMGGSVREPALSVALWLSWGAVLGAVTCAVALLIQQTELQSLRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tumor necrosis factor family


   💬 WhatsApp