PLCD_MOUSE   Q8K4X7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K4X7

Recommended name:1-acyl-sn-glycerol-3-phosphate acyltransferase delta

EC number:EC 2.3.1.51

Alternative names:(1-acylglycerol-3-phosphate O-acyltransferase 4) (1-AGP acyltransferase 4) (1-AGPAT 4) (Lysophosphatidic acid acyltransferase delta) (LPAAT-delta)

Cleaved into:

GeneID:68262

Gene names  (primary ):Agpat4

Gene names  (synonym ):

Gene names  (ORF ):

Length:378

Mass:43810

Sequence:MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTLLGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWVPPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTEIDKGSAYGNIDNKRKQTD

Tissue specificity:Expressed at a high levels in the brain, at intermediate or low levels in skeletal muscles, gut, kidney, spleen and lung (PubMed:15367102, PubMed:24333445). Barely detectable in heart and liver (PubMed:15367102). {ECO:0000269|PubMed:15367102, ECO:0000269|PubMed:24333445}.

Induction:

Developmental stage:

Protein families:1-acyl-sn-glycerol-3-phosphate acyltransferase family


   💬 WhatsApp