DHB7_MOUSE   O88736


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88736

Recommended name:3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7

EC number:EC 1.1.1.270

Alternative names:(17-beta-hydroxysteroid dehydrogenase 7) (17-beta-HSD 7) (3-keto-steroid reductase) (Dihydrotestosterone oxidoreductase) (Estradiol 17-beta-dehydrogenase 7) (EC 1.1.1.62)

Cleaved into:

GeneID:15490

Gene names  (primary ):Hsd17b7

Gene names  (synonym ):17hsd7

Gene names  (ORF ):

Length:334

Mass:37317

Sequence:MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS

Tissue specificity:Most abundant in ovaries of pregnant animals. Present also in nonpregnant animals in ovaries, mammary gland liver, kidney and testis. {ECO:0000269|PubMed:9658408}.

Induction:

Developmental stage:

Protein families:Short-chain dehydrogenases/reductases (SDR) family, ERG27 subfamily


   💬 WhatsApp