METRN_MOUSE   Q8C1Q4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C1Q4

Recommended name:Meteorin

EC number:

Alternative names:(Hypoxia/reoxygenation regulatory factor)

Cleaved into:

GeneID:70083

Gene names  (primary ):Metrn

Gene names  (synonym ):Hyrac

Gene names  (ORF ):

Length:291

Mass:31469

Sequence:MLVATLLCALCCGLLAASAHAGYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALD

Tissue specificity:Highly expressed in brain. Expressed in undifferentiated neural progenitors and in astrocyte lineage, particulary in Bergmann glia, a subtype of radial glia, and a few discrete neuronal populations residing in the superior colliculus, the ocular motor nucleus, the raphe and pontine nuclei, and in various thalamic nuclei. Weakly expressed in heart, kidney, skeletal muscle, spleen, testis, gut and lung. {ECO:0000269|PubMed:15085178, ECO:0000269|PubMed:19259827}.

Induction:By all-trans retinoic acid (ATRA). {ECO:0000269|PubMed:15085178}.

Developmental stage:

Protein families:Meteorin family


   💬 WhatsApp