METRN_MOUSE Q8C1Q4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C1Q4
Recommended name：Meteorin
EC number：
Alternative names：(Hypoxia/reoxygenation regulatory factor)
Cleaved into：
GeneID：70083
Gene names (primary )：Metrn
Gene names (synonym )：Hyrac
Gene names (ORF )：
Length：291
Mass：31469
Sequence：MLVATLLCALCCGLLAASAHAGYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALD
Tissue specificity：Highly expressed in brain. Expressed in undifferentiated neural progenitors and in astrocyte lineage, particulary in Bergmann glia, a subtype of radial glia, and a few discrete neuronal populations residing in the superior colliculus, the ocular motor nucleus, the raphe and pontine nuclei, and in various thalamic nuclei. Weakly expressed in heart, kidney, skeletal muscle, spleen, testis, gut and lung. {ECO:0000269|PubMed:15085178, ECO:0000269|PubMed:19259827}.
Induction：By all-trans retinoic acid (ATRA). {ECO:0000269|PubMed:15085178}.
Developmental stage：
Protein families：Meteorin family