GA45B_MOUSE P22339
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22339
Recommended name：Growth arrest and DNA damage-inducible protein GADD45 beta
EC number：
Alternative names：(Myeloid differentiation primary response protein MyD118) (Negative growth regulatory protein MyD118)
Cleaved into：
GeneID：17873
Gene names (primary )：Gadd45b
Gene names (synonym )：Myd118
Gene names (ORF )：
Length：160
Mass：17783
Sequence：MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
Tissue specificity：In myeloid precursor enriched BM cells.
Induction：By cytokines.
Developmental stage：
Protein families：GADD45 family