PIM3_MOUSE P58750
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P58750
Recommended name：Serine/threonine-protein kinase pim-3
EC number：EC 2.7.11.1
Alternative names：
Cleaved into：
GeneID：223775
Gene names (primary )：Pim3
Gene names (synonym )：
Gene names (ORF )：
Length：326
Mass：35970
Sequence：MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKVYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGVAVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPWMLGTEGSVPENCDLRLCALDTDDGASTTSSSESL
Tissue specificity：Detected in pancreas but exclusively in beta-cells. {ECO:0000269|PubMed:21099329}.
Induction：By glucose in pancreatic-beta-cells. {ECO:0000269|PubMed:21099329}.
Developmental stage：
Protein families：Protein kinase superfamily, CAMK Ser/Thr protein kinase family, PIM subfamily