POMP_MOUSE Q9CQT5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQT5
Recommended name：Proteasome maturation protein
EC number：
Alternative names：(Proteassemblin) (Protein UMP1 homolog) (mUMP1)
Cleaved into：
GeneID：66537
Gene names (primary )：Pomp
Gene names (synonym )：
Gene names (ORF )：
Length：141
Mass：15766
Sequence：MNARGLGSELKDSIPVAELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVHRLPFLPSSNLSLDILRGNDETIGFEDILNDPSQSELMGEPHVMVEHKLGLL
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:10891394}.
Induction：By interferon gamma. {ECO:0000269|PubMed:10973495}.
Developmental stage：
Protein families：POMP/UMP1 family