POMP_MOUSE   Q9CQT5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQT5

Recommended name:Proteasome maturation protein

EC number:

Alternative names:(Proteassemblin) (Protein UMP1 homolog) (mUMP1)

Cleaved into:

GeneID:66537

Gene names  (primary ):Pomp

Gene names  (synonym ):

Gene names  (ORF ):

Length:141

Mass:15766

Sequence:MNARGLGSELKDSIPVAELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVHRLPFLPSSNLSLDILRGNDETIGFEDILNDPSQSELMGEPHVMVEHKLGLL

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:10891394}.

Induction:By interferon gamma. {ECO:0000269|PubMed:10973495}.

Developmental stage:

Protein families:POMP/UMP1 family


   💬 WhatsApp