CCL20_MOUSE O89093
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O89093
Recommended name：C-C motif chemokine 20
EC number：
Alternative names：(Beta-chemokine exodus-1) (CC chemokine LARC) (CC chemokine ST38) (Liver and activation-regulated chemokine) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Small-inducible cytokine A20)
Cleaved into：
GeneID：20297
Gene names (primary )：Ccl20
Gene names (synonym )：Larc Scya20
Gene names (ORF )：
Length：97
Mass：10826
Sequence：MACGGKRLLFLALAWVLLAHLCSQAEAASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Tissue specificity：Thymic medulla (at protein level). Prominently expressed in the small intestine, colon and appendix. Also found in thymus, spleen, lymph node and lung. The long form might be dominant in intestinal, and the short form in lymphoid tissues. Expressed by IL17 producing helper T-cells (Th17). {ECO:0000269|PubMed:19050256, ECO:0000269|PubMed:24638065}.
Induction：By lipopolysaccharide (LPS), TNF-alpha and interleukin-1. IFN-gamma alone showed no effect, but potentiated the effect of TNF. Induced synergistically by TGFB1 and IL6, which requires STAT3, RORC and IL21. {ECO:0000269|PubMed:19050256, ECO:0000269|PubMed:9916893}.
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family