F16P2_MOUSE P70695
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70695
Recommended name:Fructose-1,6-bisphosphatase isozyme 2
EC number:EC 3.1.3.11
Alternative names:(FBPase 2) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase) (RAE-30)
Cleaved into:
GeneID:14120
Gene names (primary ):Fbp2
Gene names (synonym ):
Gene names (ORF ):
Length:339
Mass:36947
Sequence:MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLANLYGISGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKEAVITAQERRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTTEDEPSEKDALQPGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVRIKKKGKIFSLNEGYAKYFDAATAEYVQKKKFPEDGSEPYGARYVGSMVADVHRTLVYGGIFMYPANQKSPNGKLRLLYECNPVAYIIEQAGGMATTGTQPVLDVKPESIHQRVPLILGSPEDVQEYLSCVQRNQAGR
Tissue specificity:Expressed in muscle, intestine, brain and placenta and very weakly in liver. {ECO:0000269|PubMed:11250076, ECO:0000269|PubMed:8034042}.
Induction:By retinoic acid. {ECO:0000269|PubMed:8034042}.
Developmental stage:
Protein families:FBPase class 1 family