TP8L2_MOUSE   Q9D8Y7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D8Y7

Recommended name:Tumor necrosis factor alpha-induced protein 8-like protein 2

EC number:

Alternative names:(TIPE2) (TNF alpha-induced protein 8-like protein 2) (TNFAIP8-like protein 2)

Cleaved into:

GeneID:69769

Gene names  (primary ):Tnfaip8l2

Gene names  (synonym ):

Gene names  (ORF ):

Length:184

Mass:20615

Sequence:MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPKAQRVIKDLIKVAVKVAVLHRSGCFGPGELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLVECRDILLELVEHHLTPKSHDRIRHVFDHYSDPDLLAALYGPDFTQHLGKICDGLRKLLDEGKL

Tissue specificity:Expressed in thymus, spleen, lymph node and small intestine, but not in liver, heart, muscle, testis, spinal cord or brain. Up-regulated in the spinal cord of mice with experimental autoimmune encephalomyelitis. Constitutively expressed by macrophages, B and T-lymphocytes at various developmental stages. {ECO:0000269|PubMed:18455983}.

Induction:By TNF in fibroblasts. {ECO:0000269|PubMed:18455983}.

Developmental stage:

Protein families:TNFAIP8 family, TNFAIP8L2 subfamily


   💬 WhatsApp