CLC2G_MOUSE Q9D676
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D676
Recommended name：C-type lectin domain family 2 member G
EC number：
Alternative names：(DDV10) (Osteoclast inhibitory lectin-related protein 1) (Ocil-related protein 1)
Cleaved into：
GeneID：70809
Gene names (primary )：Clec2g
Gene names (synonym )：Clec2f Ddv10 Ocilrp1
Gene names (ORF )：
Length：269
Mass：30884
Sequence：MNITRASLPMLNTTCSCRREKWNFLGRYEGTFDYWIGLHRASSKHPWMWTDNTEYNNMFVYHMNAQCLKKPEEGESSPGTGGVHSYKILQRNSLRAISPESSAKLYCCCGVIMVLTVAVVALSVALPATKTEQILINKTYAACPKNWIGVGNKCFYFSEYTSNWTFAQTFCMAQEAQLARFDNEKELNFLMRYKANFDSWIGLHRESSEHPWKWTDNTEYNNMIPIQGVETCAYLSGNGISSSRHYIPRIWICSKLNNYSLHCPTPVPV
Tissue specificity：Detected in vagina, eye, tongue, stomach and spleen. {ECO:0000269|PubMed:12374791, ECO:0000269|PubMed:12746323}.
Induction：Constitutively expressed in bone marrow cells. Up-regulated in vagina after 17-beta-estradiol treatment. Down-regulated after removal of ovaries. {ECO:0000269|PubMed:12746323}.
Developmental stage：
Protein families：