ASMT_MOUSE   D3KU66


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3KU66

Recommended name:Acetylserotonin O-methyltransferase

EC number:EC 2.1.1.4

Alternative names:(Hydroxyindole O-methyltransferase)

Cleaved into:

GeneID:107626

Gene names  (primary ):Asmt

Gene names  (synonym ):Hiomt

Gene names  (ORF ):

Length:387

Mass:40925

Sequence:MHRGRSASARQERDFRALMDLAHGFMASQVLFAGCALRVFDAAALGPVDAAALARSSGLSPRGTRLLLDACAGLGLLRRRRGAGPRGPAYTNSPLASTFLVAGSPLSQRSLLLYLAGTTYLCWGHLADGVREGRSQYARAVGVDADDPFTAIYRSEAERLLFMRGLQETWSLCGGRVLTAFDLSPFRVICDLGGGSGALARMAARLYPGSEVTVFETPDVVAAARAHFPPPADEDGAEPRVRFLSGDFFRSPLPPADLYVLARVLHDWADAACVELLRRVRGALRPGGAVLLVESVLSPGGAGPTRTLLLSLTMLLQARGRERTEAEYRALTARAGFSRLRLRRPRGPYHAMMAARGGGAGARSDGGGGDATSQTGSGTGSEVGAQD

Tissue specificity:Expressed predominantly in the pineal gland. very low expression, if any, in the retina. {ECO:0000269|PubMed:20308563}.

Induction:Exhibits very slight night/day variation, if any. {ECO:0000269|PubMed:20308563}.

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family


   💬 WhatsApp