COA8_MOUSE   Q9CQW7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQW7

Recommended name:Cytochrome c oxidase assembly factor 8

EC number:

Alternative names:(COA8) (Apoptogenic protein 1, mitochondrial) (APOP-1)

Cleaved into:

GeneID:68020

Gene names  (primary ):Coa8

Gene names  (synonym ):Apop1 Apopt1

Gene names  (ORF ):

Length:192

Mass:22715

Sequence:MAALRPGSRALRRLLCRSFSGGGGVRLARERPTDHRDAASSRVSRFCPPRQSCHDWIGPPDKCSNLRPVHFHIPENESPLEQRLRELRQETQEWNQQFWAKQNLSFNKEKEEFIYSRLQAKGAGLRTESGQRATLDAEEMADFYKDFLSKNFQKHMRYNRDWYKRNFAITFFMGKVVLERMWSKLRQKKTSS

Tissue specificity:Expressed in atherosclerotic smooth muscle cells (at protein level). Expressed in aorta, brain, heart, kidney, liver, lung and spleen. Isoform 1 is strongly expressed in Kidney. Isoform 2 is strongly expressed in brain. {ECO:0000269|PubMed:16782708}.

Induction:In conditions of increased oxidative stress, the protein is stabilized, increasing its mature intramitochondrial form and thereby protecting COX from oxidatively induced degradation. {ECO:0000269|PubMed:30552096}.

Developmental stage:

Protein families:COA8 family


   💬 WhatsApp